SCOP 1.55: Domain d1fg9d1: 1fg9 D:11-109

Lineage for d1fg9d1 (1fg9 D:11-109)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (14 proteins)

6. Protein Interferon-gamma receptor alpha chain [49293] (1 species)
7. Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)

8. Domain d1fg9d1: 1fg9 D:11-109 [22062]
   Other proteins in same PDB: d1fg9a_, d1fg9b_

Details for d1fg9d1

PDB Entry: 1fg9, 2.9 Å

PDB Description: 3:1 complex of interferon-gamma receptor with interferon-gamma dimer

SCOP Domain Sequences for d1fg9d1:

Sequence; same for both SEQRES and ATOM records:

>d1fg9d1 b.1.2.1 (D:11-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens)}
svptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycni
sdhvgdpsnslwvrvkarvgqkesayakseefavcrdgk

Timeline for d1fg9d1:

• d1fg9d1 appears in SCOP 1.57
  
• d1fg9d1 appears in the current release, SCOPe 2.08