Lineage for d1fg9a_ (1fg9 A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.26: 4-helical cytokines [47265] (1 superfamily) Superfamily a.26.1: 4-helical cytokines [47266] (3 families) 
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (6 proteins) 
Protein Interferon-gamma [47318] (3 species) - Species Human (Homo sapiens) [TaxId:9606] [47320] (4 PDB entries)
Domain d1fg9a_: 1fg9 A: [16915]
Other proteins in same PDB: d1fg9c1, d1fg9c2, d1fg9d1, d1fg9d2, d1fg9e1, d1fg9e2
Details for d1fg9a_
PDB Entry: 1fg9 (more details), 2.9 Å
PDB Description: 3:1 complex of interferon-gamma receptor with interferon-gamma dimer
SCOP Domain Sequences for d1fg9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fg9a_ a.26.1.3 (A:) Interferon-gamma {Human (Homo sapiens)}
mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmae
lspaakt
SCOP Domain Coordinates for d1fg9a_:
Click to download the PDB-style file with coordinates for d1fg9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fg9a_:
- d1fg9a_ appears in SCOP 1.57
- d1fg9a_ appears in the current release, SCOPe 2.08
View in 3D
