![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Interferon-gamma receptor alpha chain [49293] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries) |
![]() | Domain d1fg9d1: 1fg9 D:11-109 [22062] Other proteins in same PDB: d1fg9a_, d1fg9b_ |
PDB Entry: 1fg9 (more details), 2.9 Å
SCOPe Domain Sequences for d1fg9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fg9d1 b.1.2.1 (D:11-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} svptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycni sdhvgdpsnslwvrvkarvgqkesayakseefavcrdgk
Timeline for d1fg9d1: