Lineage for d1fg9e2 (1fg9 E:110-221)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9780Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 9781Family b.1.2.1: Fibronectin type III [49266] (14 proteins)
  6. Protein Interferon-gamma receptor alpha chain [49293] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)
  8. 9906Domain d1fg9e2: 1fg9 E:110-221 [22065]
    Other proteins in same PDB: d1fg9a_, d1fg9b_

Details for d1fg9e2

PDB Entry: 1fg9 (more details), 2.9 Å

PDB Description: 3:1 complex of interferon-gamma receptor with interferon-gamma dimer

SCOP Domain Sequences for d1fg9e2:

Sequence, based on SEQRES records: (download)

>d1fg9e2 b.1.2.1 (E:110-221) Interferon-gamma receptor alpha chain {Human (Homo sapiens)}
igppkldirkeekqimidifhpsvfvngdeqevdydpettcyirvynvyvrmngseiqyk
iltqkeddcdeiqcqlaipvsslnsqycvsaegvlhvwgvttekskevciti

Sequence, based on observed residues (ATOM records): (download)

>d1fg9e2 b.1.2.1 (E:110-221) Interferon-gamma receptor alpha chain {Human (Homo sapiens)}
igppkldirkeekqimidifhpspettcyirvynvyvrmngseiqykiltqkeddcdeiq
cqlaipvsslnsqycvsaegvlhvwgvttekskevciti

SCOP Domain Coordinates for d1fg9e2:

Click to download the PDB-style file with coordinates for d1fg9e2.
(The format of our PDB-style files is described here.)

Timeline for d1fg9e2: