Lineage for d4dpga1 (4dpg A:71-221)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790509Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries)
  8. 2790533Domain d4dpga1: 4dpg A:71-221 [219905]
    Other proteins in same PDB: d4dpga2, d4dpgb2, d4dpgc2, d4dpgd2, d4dpge2, d4dpgf2, d4dpgg2, d4dpgh2
    automated match to d1bbua1
    protein/RNA complex; complexed with ala, apc, lys, mg

Details for d4dpga1

PDB Entry: 4dpg (more details), 2.84 Å

PDB Description: crystal structure of human lysrs: p38/aimp2 complex i
PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4dpga1:

Sequence, based on SEQRES records: (download)

>d4dpga1 b.40.4.0 (A:71-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvag
rihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgk
tkkgelsiipyeitllspclhmlphlhfglk

Sequence, based on observed residues (ATOM records): (download)

>d4dpga1 b.40.4.0 (A:71-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvag
rihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgk
tkkgelsiipyeitllspclhmlphlk

SCOPe Domain Coordinates for d4dpga1:

Click to download the PDB-style file with coordinates for d4dpga1.
(The format of our PDB-style files is described here.)

Timeline for d4dpga1: