SCOPe 2.08: Domain d4dpgd1: 4dpg D:71-221

Lineage for d4dpgd1 (4dpg D:71-221)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries)

8. Domain d4dpgd1: 4dpg D:71-221 [219911]
   Other proteins in same PDB: d4dpga2, d4dpgb2, d4dpgc2, d4dpgd2, d4dpge2, d4dpgf2, d4dpgg2, d4dpgh2
   automated match to d1bbua1
   protein/RNA complex; complexed with ala, apc, lys, mg

Details for d4dpgd1

PDB Entry: 4dpg, 2.84 Å

PDB Description: crystal structure of human lysrs: p38/aimp2 complex i

PDB Compounds: (D:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4dpgd1:

Sequence; same for both SEQRES and ATOM records:

>d4dpgd1 b.40.4.0 (D:71-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvag
rihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgk
tkkgelsiipyeitllspclhmlphlhfglk

Timeline for d4dpgd1:

• d4dpgd1 first appeared in SCOPe 2.03
  
• d4dpgd1 appears in SCOPe 2.07