Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries) |
Domain d4dpgh1: 4dpg H:71-221 [219919] Other proteins in same PDB: d4dpga2, d4dpgb2, d4dpgc2, d4dpgd2, d4dpge2, d4dpgf2, d4dpgg2, d4dpgh2 automated match to d1bbua1 protein/RNA complex; complexed with ala, apc, lys, mg |
PDB Entry: 4dpg (more details), 2.84 Å
SCOPe Domain Sequences for d4dpgh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dpgh1 b.40.4.0 (H:71-221) automated matches {Human (Homo sapiens) [TaxId: 9606]} vdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvag rihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgk tkkgelsiipyeitllspclhmlphlhfglk
Timeline for d4dpgh1: