Lineage for d4dpgh2 (4dpg H:222-575)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2968016Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2968017Protein automated matches [226887] (24 species)
    not a true protein
  7. 2968077Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries)
  8. 2968113Domain d4dpgh2: 4dpg H:222-575 [219920]
    Other proteins in same PDB: d4dpga1, d4dpgb1, d4dpgc1, d4dpgd1, d4dpge1, d4dpgf1, d4dpgg1, d4dpgh1
    automated match to d1bbua2
    protein/RNA complex; complexed with ala, apc, lys, mg

Details for d4dpgh2

PDB Entry: 4dpg (more details), 2.84 Å

PDB Description: crystal structure of human lysrs: p38/aimp2 complex i
PDB Compounds: (H:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4dpgh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dpgh2 d.104.1.0 (H:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy
mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp

SCOPe Domain Coordinates for d4dpgh2:

Click to download the PDB-style file with coordinates for d4dpgh2.
(The format of our PDB-style files is described here.)

Timeline for d4dpgh2: