![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
![]() | Protein automated matches [226887] (24 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries) |
![]() | Domain d4dpgg2: 4dpg G:222-575 [219918] Other proteins in same PDB: d4dpga1, d4dpgb1, d4dpgc1, d4dpgd1, d4dpge1, d4dpgf1, d4dpgg1, d4dpgh1 automated match to d1bbua2 protein/RNA complex; complexed with ala, apc, lys, mg |
PDB Entry: 4dpg (more details), 2.84 Å
SCOPe Domain Sequences for d4dpgg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dpgg2 d.104.1.0 (G:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]} dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp
Timeline for d4dpgg2: