SCOP 1.55: Domain d1hdma1: 1hdm A:94-196

Lineage for d1hdma1 (1hdm A:94-196)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)

7. Species Human (Homo sapiens), HLA-DM [TaxId:9606] [49133] (1 PDB entry)

8. Domain d1hdma1: 1hdm A:94-196 [21583]
   Other proteins in same PDB: d1hdma2, d1hdmb2

Details for d1hdma1

PDB Entry: 1hdm, 2.5 Å

PDB Description: histocompatibility antigen hla-dm

SCOP Domain Sequences for d1hdma1:

Sequence; same for both SEQRES and ATOM records:

>d1hdma1 b.1.1.2 (A:94-196) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DM}
srgfpiaevftlkplefgkpntlvcfvsnlfppmltvnwhdhsvpvegfgptfvsavdgl
sfqafsylnftpepsdifscivthepdrytaiaywvprnalps

Timeline for d1hdma1:

• d1hdma1 appears in SCOP 1.57
  
• d1hdma1 appears in the current release, SCOPe 2.08