| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
| Species Human (Homo sapiens), HLA-DM [TaxId:9606] [88619] (1 PDB entry) probably orthologous to the mouse H2-DM |
| Domain d1hdma1: 1hdm A:94-196 [21583] Other proteins in same PDB: d1hdma2, d1hdmb1, d1hdmb2 |
PDB Entry: 1hdm (more details), 2.5 Å
SCOPe Domain Sequences for d1hdma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]}
srgfpiaevftlkplefgkpntlvcfvsnlfppmltvnwhdhsvpvegfgptfvsavdgl
sfqafsylnftpepsdifscivthepdrytaiaywvprnalps
Timeline for d1hdma1: