Lineage for d1hdma1 (1hdm A:94-196)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53149Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (10 species)
  7. 53150Species Human (Homo sapiens), HLA-DM [TaxId:9606] [49133] (1 PDB entry)
  8. 53151Domain d1hdma1: 1hdm A:94-196 [21583]
    Other proteins in same PDB: d1hdma2, d1hdmb2

Details for d1hdma1

PDB Entry: 1hdm (more details), 2.5 Å

PDB Description: histocompatibility antigen hla-dm

SCOP Domain Sequences for d1hdma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdma1 b.1.1.2 (A:94-196) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DM}
srgfpiaevftlkplefgkpntlvcfvsnlfppmltvnwhdhsvpvegfgptfvsavdgl
sfqafsylnftpepsdifscivthepdrytaiaywvprnalps

SCOP Domain Coordinates for d1hdma1:

Click to download the PDB-style file with coordinates for d1hdma1.
(The format of our PDB-style files is described here.)

Timeline for d1hdma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdma2