| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Legionella pneumophila [TaxId:272624] [196919] (2 PDB entries) |
| Domain d3niva1: 3niv A:2-81 [213984] Other proteins in same PDB: d3niva2, d3nivb2, d3nivb3, d3nivc2, d3nivc3, d3nivd2, d3nivd3 automated match to d1e6ba2 |
PDB Entry: 3niv (more details), 2.3 Å
SCOPe Domain Sequences for d3niva1:
Sequence, based on SEQRES records: (download)
>d3niva1 c.47.1.0 (A:2-81) automated matches {Legionella pneumophila [TaxId: 272624]}
ilydyfrstacyrvrialnlkkiayekievhlvnnggeqhslqyhqinpqelvpslding
qilsqsmaiidyleeihpem
>d3niva1 c.47.1.0 (A:2-81) automated matches {Legionella pneumophila [TaxId: 272624]}
ilydyfrstacyrvrialnlkkiayekievhllvpsldingqilsqsmaiidyleeihpe
m
Timeline for d3niva1: