SCOPe 2.08: Domain d3niva2: 3niv A:82-211

Lineage for d3niva2 (3niv A:82-211)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [225922] (1 PDB entry)

8. Domain d3niva2: 3niv A:82-211 [213985]
   Other proteins in same PDB: d3niva1, d3nivb1, d3nivb3, d3nivc1, d3nivc3, d3nivd1, d3nivd3
   automated match to d1e6ba1

Details for d3niva2

PDB Entry: 3niv, 2.3 Å

PDB Description: the crystal structure of glutathione s-transferase from legionella pneumophila

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3niva2:

Sequence; same for both SEQRES and ATOM records:

>d3niva2 a.45.1.0 (A:82-211) automated matches {Legionella pneumophila [TaxId: 272624]}
pllpkdpfmkatlksmalivacdmhplnnlrvlnrlkeqfnaneeqvlewyhhwlktgfd
afeeklgalerdkpvcfgsevgladvclipqvynahrfhfdmasypiineineycltlpa
fhdaapeais

Timeline for d3niva2:

• d3niva2 first appeared in SCOPe 2.03
  
• d3niva2 appears in SCOPe 2.07