SCOPe 2.03: Domain d3niva1: 3niv A:2-81

Lineage for d3niva1 (3niv A:2-81)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [196919] (2 PDB entries)

8. Domain d3niva1: 3niv A:2-81 [213984]
   Other proteins in same PDB: d3niva2, d3nivb2, d3nivc2, d3nivd2
   automated match to d1e6ba2

Details for d3niva1

PDB Entry: 3niv, 2.3 Å

PDB Description: the crystal structure of glutathione s-transferase from legionella pneumophila

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3niva1:

Sequence, based on SEQRES records:

>d3niva1 c.47.1.0 (A:2-81) automated matches {Legionella pneumophila [TaxId: 272624]}
ilydyfrstacyrvrialnlkkiayekievhlvnnggeqhslqyhqinpqelvpslding
qilsqsmaiidyleeihpem

Sequence, based on observed residues (ATOM records):

>d3niva1 c.47.1.0 (A:2-81) automated matches {Legionella pneumophila [TaxId: 272624]}
ilydyfrstacyrvrialnlkkiayekievhllvpsldingqilsqsmaiidyleeihpe
m

Timeline for d3niva1:

• d3niva1 is new in SCOPe 2.03-stable
  
• d3niva1 appears in SCOPe 2.04
  
• d3niva1 appears in the current release, SCOPe 2.08