PDB entry 3niv

View 3niv on RCSB PDB site
Description: The crystal structure of Glutathione S-transferase from Legionella pneumophila
Class: isomerase
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, SGX, PSI, ISOMERASE
Deposited on 2010-06-16, released 2010-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
    Gene: lpg2280
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3niva1, d3niva2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
    Gene: lpg2280
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZT82 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3nivb1, d3nivb2, d3nivb3
  • Chain 'C':
    Compound: glutathione s-transferase
    Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
    Gene: lpg2280
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZT82 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3nivc1, d3nivc2, d3nivc3
  • Chain 'D':
    Compound: glutathione s-transferase
    Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
    Gene: lpg2280
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZT82 (3-213)
      • expression tag (2)
    Domains in SCOPe 2.07: d3nivd1, d3nivd2, d3nivd3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nivA (A:)
    mslilydyfrstacyrvrialnlkkiayekievhlvnnggeqhslqyhqinpqelvpsld
    ingqilsqsmaiidyleeihpempllpkdpfmkatlksmalivacdmhplnnlrvlnrlk
    eqfnaneeqvlewyhhwlktgfdafeeklgalerdkpvcfgsevgladvclipqvynahr
    fhfdmasypiineineycltlpafhdaapeaisseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nivA (A:)
    ilydyfrstacyrvrialnlkkiayekievhllvpsldingqilsqsmaiidyleeihpe
    mpllpkdpfmkatlksmalivacdmhplnnlrvlnrlkeqfnaneeqvlewyhhwlktgf
    dafeeklgalerdkpvcfgsevgladvclipqvynahrfhfdmasypiineineycltlp
    afhdaapeais
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nivB (B:)
    mslilydyfrstacyrvrialnlkkiayekievhlvnnggeqhslqyhqinpqelvpsld
    ingqilsqsmaiidyleeihpempllpkdpfmkatlksmalivacdmhplnnlrvlnrlk
    eqfnaneeqvlewyhhwlktgfdafeeklgalerdkpvcfgsevgladvclipqvynahr
    fhfdmasypiineineycltlpafhdaapeaisseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nivB (B:)
    lilydyfrstacyrvrialnlkkiayekievvpsldingqilsqsmaiidyleeihpemp
    llpkdpfmkatlksmalivacdmhplnnlrvlnrlkeqfnaneeqvlewyhhwlktgfda
    feeklgalerdkpvcfgsevgladvclipqvynahrfhfdmasypiineineycltlpaf
    hdaapeai
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nivC (C:)
    mslilydyfrstacyrvrialnlkkiayekievhlvnnggeqhslqyhqinpqelvpsld
    ingqilsqsmaiidyleeihpempllpkdpfmkatlksmalivacdmhplnnlrvlnrlk
    eqfnaneeqvlewyhhwlktgfdafeeklgalerdkpvcfgsevgladvclipqvynahr
    fhfdmasypiineineycltlpafhdaapeaisseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nivC (C:)
    lilydyfrstacyrvrialnlkkiayekievhlvnlvpsldingqilsqsmaiidyleei
    hpempllpkdpfmkatlksmalivacdmhplnnlrvlnrlkeqfnaneeqvlewyhhwlk
    tgfdafeeklgalerdkpvcfgsevgladvclipqvynahrfhfdmasypiineineycl
    tlpafhdaape
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nivD (D:)
    mslilydyfrstacyrvrialnlkkiayekievhlvnnggeqhslqyhqinpqelvpsld
    ingqilsqsmaiidyleeihpempllpkdpfmkatlksmalivacdmhplnnlrvlnrlk
    eqfnaneeqvlewyhhwlktgfdafeeklgalerdkpvcfgsevgladvclipqvynahr
    fhfdmasypiineineycltlpafhdaapeaisseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nivD (D:)
    lilydyfrstacyrvrialnlkkiayekievelvpsldingqilsqsmaiidyleeihpe
    mpllpkdpfmkatlksmalivacdmhplnnlrvlnrlkeqfnaneeqvlewyhhwlktgf
    dafeeklgalerdkpvcfgsevgladvclipqvynahrfhfdmasypiineineycltlp
    afhdaapeaiss