Lineage for d3nivb2 (3niv B:82-210)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714057Species Legionella pneumophila [TaxId:272624] [225922] (1 PDB entry)
  8. 2714059Domain d3nivb2: 3niv B:82-210 [213987]
    Other proteins in same PDB: d3niva1, d3nivb1, d3nivb3, d3nivc1, d3nivc3, d3nivd1, d3nivd3
    automated match to d1e6ba1

Details for d3nivb2

PDB Entry: 3niv (more details), 2.3 Å

PDB Description: the crystal structure of glutathione s-transferase from legionella pneumophila
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d3nivb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nivb2 a.45.1.0 (B:82-210) automated matches {Legionella pneumophila [TaxId: 272624]}
pllpkdpfmkatlksmalivacdmhplnnlrvlnrlkeqfnaneeqvlewyhhwlktgfd
afeeklgalerdkpvcfgsevgladvclipqvynahrfhfdmasypiineineycltlpa
fhdaapeai

SCOPe Domain Coordinates for d3nivb2:

Click to download the PDB-style file with coordinates for d3nivb2.
(The format of our PDB-style files is described here.)

Timeline for d3nivb2: