| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Legionella pneumophila [TaxId:272624] [225922] (1 PDB entry) |
| Domain d3nivb2: 3niv B:82-210 [213987] Other proteins in same PDB: d3niva1, d3nivb1, d3nivb3, d3nivc1, d3nivc3, d3nivd1, d3nivd3 automated match to d1e6ba1 |
PDB Entry: 3niv (more details), 2.3 Å
SCOPe Domain Sequences for d3nivb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nivb2 a.45.1.0 (B:82-210) automated matches {Legionella pneumophila [TaxId: 272624]}
pllpkdpfmkatlksmalivacdmhplnnlrvlnrlkeqfnaneeqvlewyhhwlktgfd
afeeklgalerdkpvcfgsevgladvclipqvynahrfhfdmasypiineineycltlpa
fhdaapeai
Timeline for d3nivb2: