Lineage for d4g7ol1 (4g7o L:4-49,L:173-228)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958149Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2958150Protein RNA polymerase alpha [55259] (3 species)
  7. 2958165Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2958177Domain d4g7ol1: 4g7o L:4-49,L:173-228 [202213]
    Other proteins in same PDB: d4g7oa2, d4g7ob2, d4g7oc_, d4g7od_, d4g7oe_, d4g7of1, d4g7of2, d4g7of3, d4g7ok2, d4g7ol2, d4g7om_, d4g7on_, d4g7oo_, d4g7op1, d4g7op2, d4g7op3
    automated match to d1smya1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7ol1

PDB Entry: 4g7o (more details), 2.99 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex containing 2 nt of RNA
PDB Compounds: (L:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d4g7ol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7ol1 d.74.3.1 (L:4-49,L:173-228) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
sklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtr
lgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnp

SCOPe Domain Coordinates for d4g7ol1:

Click to download the PDB-style file with coordinates for d4g7ol1.
(The format of our PDB-style files is described here.)

Timeline for d4g7ol1: