| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) ![]() |
| Family a.177.1.0: automated matches [254327] (1 protein) not a true family |
| Protein automated matches [254748] (2 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [256265] (2 PDB entries) |
| Domain d4g7op1: 4g7o P:77-257 [240155] Other proteins in same PDB: d4g7oa1, d4g7oa2, d4g7ob1, d4g7ob2, d4g7oc_, d4g7od_, d4g7oe_, d4g7of2, d4g7of3, d4g7ok1, d4g7ok2, d4g7ol1, d4g7ol2, d4g7om_, d4g7on_, d4g7oo_, d4g7op2, d4g7op3 automated match to d1smyf3 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 4g7o (more details), 2.99 Å
SCOPe Domain Sequences for d4g7op1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g7op1 a.177.1.0 (P:77-257) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakil
gsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvv
siakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqar
t
Timeline for d4g7op1: