Lineage for d4g7op1 (4g7o P:77-257)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735969Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2735970Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2736028Family a.177.1.0: automated matches [254327] (1 protein)
    not a true family
  6. 2736029Protein automated matches [254748] (2 species)
    not a true protein
  7. 2736030Species Thermus thermophilus HB8 [TaxId:300852] [256265] (2 PDB entries)
  8. 2736034Domain d4g7op1: 4g7o P:77-257 [240155]
    Other proteins in same PDB: d4g7oa1, d4g7oa2, d4g7ob1, d4g7ob2, d4g7oc_, d4g7od_, d4g7oe_, d4g7of2, d4g7of3, d4g7ok1, d4g7ok2, d4g7ol1, d4g7ol2, d4g7om_, d4g7on_, d4g7oo_, d4g7op2, d4g7op3
    automated match to d1smyf3
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7op1

PDB Entry: 4g7o (more details), 2.99 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex containing 2 nt of RNA
PDB Compounds: (P:) RNA polymerase sigma factor

SCOPe Domain Sequences for d4g7op1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7op1 a.177.1.0 (P:77-257) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakil
gsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvv
siakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqar
t

SCOPe Domain Coordinates for d4g7op1:

Click to download the PDB-style file with coordinates for d4g7op1.
(The format of our PDB-style files is described here.)

Timeline for d4g7op1: