SCOPe 2.08: Domain d4g7ob2: 4g7o B:50-172

Lineage for d4g7ob2 (4g7o B:50-172)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d4g7ob2: 4g7o B:50-172 [202208]
   Other proteins in same PDB: d4g7oa1, d4g7ob1, d4g7oc_, d4g7od_, d4g7oe_, d4g7of1, d4g7of2, d4g7of3, d4g7ok1, d4g7ol1, d4g7om_, d4g7on_, d4g7oo_, d4g7op1, d4g7op2, d4g7op3
   automated match to d1smya2
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7ob2

PDB Entry: 4g7o, 2.99 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex containing 2 nt of RNA

PDB Compounds: (B:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d4g7ob2:

Sequence; same for both SEQRES and ATOM records:

>d4g7ob2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

Timeline for d4g7ob2:

• d4g7ob2 first appeared in SCOPe 2.03
  
• d4g7ob2 appears in SCOPe 2.07