Lineage for d4g7oa2 (4g7o A:50-172)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2561810Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 2561811Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 2561812Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)
  6. 2561813Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 2561828Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2561837Domain d4g7oa2: 4g7o A:50-172 [202206]
    Other proteins in same PDB: d4g7oa1, d4g7ob1, d4g7oc_, d4g7od_, d4g7oe_, d4g7of1, d4g7of2, d4g7of3, d4g7ok1, d4g7ol1, d4g7om_, d4g7on_, d4g7oo_, d4g7op1, d4g7op2, d4g7op3
    automated match to d1smya2
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7oa2

PDB Entry: 4g7o (more details), 2.99 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex containing 2 nt of RNA
PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d4g7oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7oa2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d4g7oa2:

Click to download the PDB-style file with coordinates for d4g7oa2.
(The format of our PDB-style files is described here.)

Timeline for d4g7oa2: