Lineage for d4g7of2 (4g7o F:258-318)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695832Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 2695938Family a.4.13.0: automated matches [254211] (1 protein)
    not a true family
  6. 2695939Protein automated matches [254475] (4 species)
    not a true protein
  7. 2695947Species Thermus thermophilus HB8 [TaxId:300852] [255804] (3 PDB entries)
  8. 2695952Domain d4g7of2: 4g7o F:258-318 [240153]
    Other proteins in same PDB: d4g7oa1, d4g7oa2, d4g7ob1, d4g7ob2, d4g7oc_, d4g7od_, d4g7oe_, d4g7of1, d4g7ok1, d4g7ok2, d4g7ol1, d4g7ol2, d4g7om_, d4g7on_, d4g7oo_, d4g7op1
    automated match to d1smyf1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7of2

PDB Entry: 4g7o (more details), 2.99 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex containing 2 nt of RNA
PDB Compounds: (F:) RNA polymerase sigma factor

SCOPe Domain Sequences for d4g7of2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7of2 a.4.13.0 (F:258-318) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d4g7of2:

Click to download the PDB-style file with coordinates for d4g7of2.
(The format of our PDB-style files is described here.)

Timeline for d4g7of2: