SCOP 1.55: Domain d1fbiq1: 1fbi Q:1-121

Lineage for d1fbiq1 (1fbi Q:1-121)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab F9.13.7 (mouse), kappa L chain [48795] (1 PDB entry)

8. Domain d1fbiq1: 1fbi Q:1-121 [20027]
   Other proteins in same PDB: d1fbih2, d1fbil2, d1fbip2, d1fbiq2, d1fbix_, d1fbiy_

Details for d1fbiq1

PDB Entry: 1fbi, 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

SCOP Domain Sequences for d1fbiq1:

Sequence; same for both SEQRES and ATOM records:

>d1fbiq1 b.1.1.1 (Q:1-121) Immunoglobulin (variable domains of L and H chains) {Fab F9.13.7 (mouse), kappa L chain}
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqgpgqglewigeidpsdsypny
nekfkgkatltvdkssstaymqlssltsedsavyycaslyyygtsygvldywgqgtsvtv
s

Timeline for d1fbiq1:

• d1fbiq1 appears in SCOP 1.57
  
• d1fbiq1 appears in the current release, SCOPe 2.08