SCOP 1.55: Domain d1fbil2: 1fbi L:108-214

Lineage for d1fbil2 (1fbi L:108-214)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab F9.13.7 (mouse), kappa L chain [49015] (1 PDB entry)

8. Domain d1fbil2: 1fbi L:108-214 [21078]
   Other proteins in same PDB: d1fbih1, d1fbil1, d1fbip1, d1fbiq1, d1fbix_, d1fbiy_

Details for d1fbil2

PDB Entry: 1fbi, 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

SCOP Domain Sequences for d1fbil2:

Sequence; same for both SEQRES and ATOM records:

>d1fbil2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab F9.13.7 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1fbil2:

• d1fbil2 appears in SCOP 1.57
  
• d1fbil2 appears in the current release, SCOPe 2.08