Lineage for d1fbiy_ (1fbi Y:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28802Protein Lysozyme [53961] (13 species)
  7. 28955Species Guinea fowl (Numida meleagris) [TaxId:8996] [53964] (2 PDB entries)
  8. 28958Domain d1fbiy_: 1fbi Y: [36400]
    Other proteins in same PDB: d1fbih1, d1fbih2, d1fbil1, d1fbil2, d1fbip1, d1fbip2, d1fbiq1, d1fbiq2

Details for d1fbiy_

PDB Entry: 1fbi (more details), 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

SCOP Domain Sequences for d1fbiy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbiy_ d.2.1.2 (Y:) Lysozyme {Guinea fowl (Numida meleagris)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
rwwcndgrtpgsrnlcnipcsalqssditatancakkivsdgngmnawvawrkhckgtdv
rvwikgcrl

SCOP Domain Coordinates for d1fbiy_:

Click to download the PDB-style file with coordinates for d1fbiy_.
(The format of our PDB-style files is described here.)

Timeline for d1fbiy_: