| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) ![]() automatically mapped to Pfam PF01000 |
| Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) |
| Protein RNA polymerase alpha subunit [56555] (3 species) |
| Species Thermus thermophilus [TaxId:274] [75595] (13 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
| Domain d3eqla2: 3eql A:50-172 [199359] Other proteins in same PDB: d3eqla1, d3eqlb1, d3eqlc_, d3eqld_, d3eqle_, d3eqlf1, d3eqlf2, d3eqlf3, d3eqlk1, d3eqll1, d3eqlm_, d3eqln_, d3eqlo_, d3eqlp1, d3eqlp2, d3eqlp3 automated match to d1smya2 protein/DNA complex; protein/RNA complex; complexed with mg, mxp, zn |
PDB Entry: 3eql (more details), 2.7 Å
SCOPe Domain Sequences for d3eqla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eqla2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs
Timeline for d3eqla2: