Class a: All alpha proteins [46456] (284 folds) |
Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) |
Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (5 proteins) |
Protein Sigma70 [88948] (2 species) |
Species Thermus thermophilus [TaxId:274] [88949] (10 PDB entries) Uniprot Q9WX78 |
Domain d3eqlp1: 3eql P:74-257 [199371] Other proteins in same PDB: d3eqla1, d3eqla2, d3eqlb1, d3eqlb2, d3eqlc_, d3eqld_, d3eqle_, d3eqlf2, d3eqlf3, d3eqlk1, d3eqlk2, d3eqll1, d3eqll2, d3eqlm_, d3eqln_, d3eqlo_, d3eqlp2, d3eqlp3 automated match to d1smyf3 protein/DNA complex; protein/RNA complex; complexed with mg, mxp, zn |
PDB Entry: 3eql (more details), 2.7 Å
SCOPe Domain Sequences for d3eqlp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eqlp1 a.177.1.1 (P:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]} kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad qart
Timeline for d3eqlp1: