| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) ![]() form homo and heterodimers |
| Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
| Protein RNA polymerase alpha [55259] (3 species) |
| Species Thermus thermophilus [TaxId:274] [75478] (13 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
| Domain d3eqla1: 3eql A:1-49,A:173-229 [199358] Other proteins in same PDB: d3eqla2, d3eqlb2, d3eqlc_, d3eqld_, d3eqle_, d3eqlf1, d3eqlf2, d3eqlf3, d3eqlk2, d3eqll2, d3eqlm_, d3eqln_, d3eqlo_, d3eqlp1, d3eqlp2, d3eqlp3 automated match to d1smya1 protein/DNA complex; protein/RNA complex; complexed with mg, mxp, zn |
PDB Entry: 3eql (more details), 2.7 Å
SCOPe Domain Sequences for d3eqla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eqla1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
Timeline for d3eqla1: