SCOPe 2.03: Domain d3eqll1: 3eql L:1-49,L:173-229

Lineage for d3eqll1 (3eql L:1-49,L:173-229)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (13 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d3eqll1: 3eql L:1-49,L:173-229 [199368]
   Other proteins in same PDB: d3eqla2, d3eqlb2, d3eqlc_, d3eqld_, d3eqle_, d3eqlf1, d3eqlf2, d3eqlf3, d3eqlk2, d3eqll2, d3eqlm_, d3eqln_, d3eqlo_, d3eqlp1, d3eqlp2, d3eqlp3
   automated match to d1smya1
   protein/DNA complex; protein/RNA complex; complexed with mg, mxp, zn

Details for d3eqll1

PDB Entry: 3eql, 2.7 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic myxopyronin

PDB Compounds: (L:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d3eqll1:

Sequence; same for both SEQRES and ATOM records:

>d3eqll1 d.74.3.1 (L:1-49,L:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

Timeline for d3eqll1:

• d3eqll1 is new in SCOPe 2.03-stable
  
• d3eqll1 appears in SCOPe 2.04
  
• d3eqll1 appears in the current release, SCOPe 2.08