Lineage for d3eqll1 (3eql L:1-49,L:173-229)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958149Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2958150Protein RNA polymerase alpha [55259] (3 species)
  7. 2958165Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2958205Domain d3eqll1: 3eql L:1-49,L:173-229 [199368]
    Other proteins in same PDB: d3eqla2, d3eqlb2, d3eqlc_, d3eqld_, d3eqle_, d3eqlf1, d3eqlf2, d3eqlf3, d3eqlk2, d3eqll2, d3eqlm_, d3eqln_, d3eqlo_, d3eqlp1, d3eqlp2, d3eqlp3
    automated match to d1smya1
    protein/DNA complex; protein/RNA complex; complexed with mg, mxp, zn

Details for d3eqll1

PDB Entry: 3eql (more details), 2.7 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic myxopyronin
PDB Compounds: (L:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d3eqll1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eqll1 d.74.3.1 (L:1-49,L:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

SCOPe Domain Coordinates for d3eqll1:

Click to download the PDB-style file with coordinates for d3eqll1.
(The format of our PDB-style files is described here.)

Timeline for d3eqll1: