Lineage for d3eqla2 (3eql A:50-172)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684390Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1684391Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 1684392Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1684393Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 1684408Species Thermus thermophilus [TaxId:274] [75595] (14 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 1684445Domain d3eqla2: 3eql A:50-172 [199359]
    Other proteins in same PDB: d3eqla1, d3eqlb1, d3eqlc_, d3eqld_, d3eqle_, d3eqlf1, d3eqlf2, d3eqlf3, d3eqlk1, d3eqll1, d3eqlm_, d3eqln_, d3eqlo_, d3eqlp1, d3eqlp2, d3eqlp3
    automated match to d1smya2
    protein/DNA complex; protein/RNA complex; complexed with mg, mxp, zn

Details for d3eqla2

PDB Entry: 3eql (more details), 2.7 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic myxopyronin
PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d3eqla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eqla2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d3eqla2:

Click to download the PDB-style file with coordinates for d3eqla2.
(The format of our PDB-style files is described here.)

Timeline for d3eqla2: