Lineage for d3eqlo_ (3eql O:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506616Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1506617Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1506618Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 1506619Protein RNA polymerase omega subunit [63564] (3 species)
  7. 1506637Species Thermus thermophilus [TaxId:274] [74729] (10 PDB entries)
    Uniprot Q8RQE7; part of multichain biological unit
  8. 1506651Domain d3eqlo_: 3eql O: [175159]
    Other proteins in same PDB: d3eqla1, d3eqla2, d3eqlb1, d3eqlb2, d3eqlc_, d3eqld_, d3eqlf1, d3eqlf2, d3eqlf3, d3eqlk1, d3eqlk2, d3eqll1, d3eqll2, d3eqlm_, d3eqln_, d3eqlp1, d3eqlp2, d3eqlp3
    automated match to d1i6ve_
    protein/DNA complex; protein/RNA complex; complexed with mg, mxp, zn

Details for d3eqlo_

PDB Entry: 3eql (more details), 2.7 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic myxopyronin
PDB Compounds: (O:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d3eqlo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eqlo_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypve

SCOPe Domain Coordinates for d3eqlo_:

Click to download the PDB-style file with coordinates for d3eqlo_.
(The format of our PDB-style files is described here.)

Timeline for d3eqlo_: