SCOPe 2.08: Domain d3eqla2: 3eql A:50-172

Lineage for d3eqla2 (3eql A:50-172)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d3eqla2: 3eql A:50-172 [199359]
   Other proteins in same PDB: d3eqla1, d3eqlb1, d3eqlc_, d3eqld_, d3eqle_, d3eqlf1, d3eqlf2, d3eqlf3, d3eqlk1, d3eqll1, d3eqlm_, d3eqln_, d3eqlo_, d3eqlp1, d3eqlp2, d3eqlp3
   automated match to d1smya2
   protein/DNA complex; protein/RNA complex; complexed with mg, mxp, zn

Details for d3eqla2

PDB Entry: 3eql, 2.7 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic myxopyronin

PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d3eqla2:

Sequence; same for both SEQRES and ATOM records:

>d3eqla2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

Timeline for d3eqla2:

• d3eqla2 first appeared in SCOPe 2.03
  
• d3eqla2 appears in SCOPe 2.07