![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
![]() | Family a.4.13.1: Sigma3 domain [88660] (3 proteins) |
![]() | Protein Sigma70 [88661] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [88662] (11 PDB entries) Uniprot Q9WX78 |
![]() | Domain d3eqlf2: 3eql F:258-318 [199364] Other proteins in same PDB: d3eqla1, d3eqla2, d3eqlb1, d3eqlb2, d3eqlc_, d3eqld_, d3eqle_, d3eqlf1, d3eqlf3, d3eqlk1, d3eqlk2, d3eqll1, d3eqll2, d3eqlm_, d3eqln_, d3eqlo_, d3eqlp1, d3eqlp3 automated match to d1smyf1 protein/DNA complex; protein/RNA complex; complexed with mg, mxp, zn |
PDB Entry: 3eql (more details), 2.7 Å
SCOPe Domain Sequences for d3eqlf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eqlf2 a.4.13.1 (F:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]} iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl e
Timeline for d3eqlf2: