Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) |
Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
Protein Sigma70 (SigA, RpoD) [88666] (4 species) Pfam PF03979 |
Species Thermus thermophilus [TaxId:274] [88667] (11 PDB entries) Uniprot Q9WX78 |
Domain d3eqlf3: 3eql F:319-423 [199365] Other proteins in same PDB: d3eqla1, d3eqla2, d3eqlb1, d3eqlb2, d3eqlc_, d3eqld_, d3eqle_, d3eqlf1, d3eqlf2, d3eqlk1, d3eqlk2, d3eqll1, d3eqll2, d3eqlm_, d3eqln_, d3eqlo_, d3eqlp1, d3eqlp2 automated match to d1smyf2 protein/DNA complex; protein/RNA complex; complexed with mg, mxp, zn |
PDB Entry: 3eql (more details), 2.7 Å
SCOPe Domain Sequences for d3eqlf3:
Sequence, based on SEQRES records: (download)
>d3eqlf3 a.4.13.2 (F:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]} tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld
>d3eqlf3 a.4.13.2 (F:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]} tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg eevgaffgvtrerirqienkalrklkyhesrtrklrdfld
Timeline for d3eqlf3: