Lineage for d1cid_1 (1cid 1-105)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) 
Protein CD4 [48737] (2 species) 
Species Rat (Rattus rattus) [TaxId:10117] [48739] (1 PDB entry) 
Domain d1cid_1: 1cid 1-105 [19740]
Other proteins in same PDB: d1cid_2
Details for d1cid_1
PDB Entry: 1cid (more details), 2.8 Å
PDB Description: crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains
SCOP Domain Sequences for d1cid_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cid_1 b.1.1.1 (1-105) CD4 {Rat (Rattus rattus)}
tsitayksegesaefsfplnlgeeslqgelrwkaekapssqswitfslknqkvsvqksts
npkfqlsetlpltlqipqvslqfagsgnltltldrgilyqevnlv
SCOP Domain Coordinates for d1cid_1:
Click to download the PDB-style file with coordinates for d1cid_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cid_1:
- d1cid_1 appears in SCOP 1.57
- d1cid_1 appears in the current release, SCOPe 2.08, called d1cida1
View in 3D
