Lineage for d1cid_1 (1cid 1-105)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 52814Protein N-terminal domain of CD4 [48737] (2 species)
  7. 52838Species Rat (Rattus rattus) [TaxId:10117] [48739] (1 PDB entry)
  8. 52839Domain d1cid_1: 1cid 1-105 [19740]
    Other proteins in same PDB: d1cid_2

Details for d1cid_1

PDB Entry: 1cid (more details), 2.8 Å

PDB Description: crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains

SCOP Domain Sequences for d1cid_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cid_1 b.1.1.1 (1-105) N-terminal domain of CD4 {Rat (Rattus rattus)}
tsitayksegesaefsfplnlgeeslqgelrwkaekapssqswitfslknqkvsvqksts
npkfqlsetlpltlqipqvslqfagsgnltltldrgilyqevnlv

SCOP Domain Coordinates for d1cid_1:

Click to download the PDB-style file with coordinates for d1cid_1.
(The format of our PDB-style files is described here.)

Timeline for d1cid_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cid_2