![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein N-terminal domain of CD4 [48737] (2 species) |
![]() | Species Rat (Rattus rattus) [TaxId:10117] [48739] (1 PDB entry) |
![]() | Domain d1cid_1: 1cid 1-105 [19740] Other proteins in same PDB: d1cid_2 |
PDB Entry: 1cid (more details), 2.8 Å
SCOP Domain Sequences for d1cid_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cid_1 b.1.1.1 (1-105) N-terminal domain of CD4 {Rat (Rattus rattus)} tsitayksegesaefsfplnlgeeslqgelrwkaekapssqswitfslknqkvsvqksts npkfqlsetlpltlqipqvslqfagsgnltltldrgilyqevnlv
Timeline for d1cid_1: