PDB entry 1cid

View 1cid on RCSB PDB site
Description: crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains
Deposited on 1993-01-28, released 1993-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.233
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cid_ (-)
    tsitayksegesaefsfplnlgeeslqgelrwkaekapssqswitfslknqkvsvqksts
    npkfqlsetlpltlqipqvslqfagsgnltltldrgilyqevnlvvmkvtqpdsntltce
    vmgptspkmrlilkqenqearvsrqekviqvqapeagvwqcllsegeevkmdskiqv