Lineage for d3kuyh_ (3kuy H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698177Protein Histone H2B [47119] (6 species)
  7. 2698178Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (42 PDB entries)
  8. 2698229Domain d3kuyh_: 3kuy H: [191752]
    Other proteins in same PDB: d3kuya_, d3kuyb_, d3kuyc_, d3kuye_, d3kuyf_, d3kuyg_
    automated match to d1kx5d_
    protein/DNA complex; complexed with atv, mn

Details for d3kuyh_

PDB Entry: 3kuy (more details), 2.9 Å

PDB Description: DNA Stretching in the Nucleosome Facilitates Alkylation by an Intercalating Antitumor Agent
PDB Compounds: (H:) histone h2b

SCOPe Domain Sequences for d3kuyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kuyh_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsak

SCOPe Domain Coordinates for d3kuyh_:

Click to download the PDB-style file with coordinates for d3kuyh_.
(The format of our PDB-style files is described here.)

Timeline for d3kuyh_: