Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (7 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries) |
Domain d3kuyf_: 3kuy F: [191751] Other proteins in same PDB: d3kuya_, d3kuyc_, d3kuyd_, d3kuye_, d3kuyg_, d3kuyh_ automated match to d1kx5b_ protein/DNA complex; complexed with atv, mn |
PDB Entry: 3kuy (more details), 2.9 Å
SCOPe Domain Sequences for d3kuyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kuyf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh akrktvtamdvvyalkrqgrtlygfgg
Timeline for d3kuyf_: