| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2B [47119] (6 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (42 PDB entries) |
| Domain d3kuyd_: 3kuy D: [191750] Other proteins in same PDB: d3kuya_, d3kuyb_, d3kuyc_, d3kuye_, d3kuyf_, d3kuyg_ automated match to d1kx5d_ protein/DNA complex; complexed with atv, mn |
PDB Entry: 3kuy (more details), 2.9 Å
SCOPe Domain Sequences for d3kuyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kuyd_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d3kuyd_: