Lineage for d3kuyd_ (3kuy D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2310258Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 2310354Protein Histone H2B [47119] (6 species)
  7. 2310355Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (39 PDB entries)
  8. 2310407Domain d3kuyd_: 3kuy D: [191750]
    Other proteins in same PDB: d3kuya_, d3kuyb_, d3kuyc_, d3kuye_, d3kuyf_, d3kuyg_
    automated match to d1kx5d_
    protein/DNA complex; complexed with atv, mn

Details for d3kuyd_

PDB Entry: 3kuy (more details), 2.9 Å

PDB Description: DNA Stretching in the Nucleosome Facilitates Alkylation by an Intercalating Antitumor Agent
PDB Compounds: (D:) histone h2b

SCOPe Domain Sequences for d3kuyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kuyd_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsak

SCOPe Domain Coordinates for d3kuyd_:

Click to download the PDB-style file with coordinates for d3kuyd_.
(The format of our PDB-style files is described here.)

Timeline for d3kuyd_: