Lineage for d3kuye_ (3kuy E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2310258Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 2310460Protein Histone H3 [47122] (6 species)
  7. 2310461Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 2310520Domain d3kuye_: 3kuy E: [179730]
    Other proteins in same PDB: d3kuyb_, d3kuyc_, d3kuyd_, d3kuyf_, d3kuyg_, d3kuyh_
    automated match to d1kx5a_
    protein/DNA complex; complexed with atv, mn

Details for d3kuye_

PDB Entry: 3kuy (more details), 2.9 Å

PDB Description: DNA Stretching in the Nucleosome Facilitates Alkylation by an Intercalating Antitumor Agent
PDB Compounds: (E:) Histone H3.2

SCOPe Domain Sequences for d3kuye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kuye_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvtimpkdiqlarrirge

SCOPe Domain Coordinates for d3kuye_:

Click to download the PDB-style file with coordinates for d3kuye_.
(The format of our PDB-style files is described here.)

Timeline for d3kuye_: