SCOP 1.63: Domain d1ap7__: 1ap7 -

Lineage for d1ap7__ (1ap7 -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (1 family)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (12 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein Cell cycle inhibitor p16ink4A [48414] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48416] (1 PDB entry)

8. Domain d1ap7__: 1ap7 - [19170]

Details for d1ap7__

PDB Entry: 1ap7

PDB Description: p19-ink4d from mouse, nmr, 20 structures

SCOP Domain Sequences for d1ap7__:

Sequence; same for both SEQRES and ATOM records:

>d1ap7__ d.211.1.1 (-) Cell cycle inhibitor p16ink4A {Mouse (Mus musculus)}
gsmlleevcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspaval
ellkqgaspnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireg
hssvvsflapesdlhhrdasgltplelarqrgaqnlmdilqghmmipm

Timeline for d1ap7__:

• d1ap7__ first appeared (with stable ids) in SCOP 1.55
  
• d1ap7__ appears in SCOP 1.61
  
• d1ap7__ appears in SCOP 1.65
  
• d1ap7__ appears in the current release, SCOPe 2.08, called d1ap7a_