| Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
| Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) |
Superfamily d.211.1: Ankyrin repeat [48403] (1 family) ![]() |
| Family d.211.1.1: Ankyrin repeat [48404] (10 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
| Protein Cell cycle inhibitor p16ink4A [48414] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [48416] (1 PDB entry) |
| Domain d1ap7__: 1ap7 - [19170] |
PDB Entry: 1ap7 (more details)
SCOP Domain Sequences for d1ap7__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ap7__ d.211.1.1 (-) Cell cycle inhibitor p16ink4A {Mouse (Mus musculus)}
gsmlleevcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspaval
ellkqgaspnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireg
hssvvsflapesdlhhrdasgltplelarqrgaqnlmdilqghmmipm
Timeline for d1ap7__: