Lineage for d1ap7__ (1ap7 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6122Superfamily a.118.2: Ankyrin repeat [48403] (1 family) (S)
  5. 6123Family a.118.2.1: Ankyrin repeat [48404] (9 proteins)
  6. 6127Protein Cell cycle inhibitor p16ink4A [48414] (2 species)
  7. 6133Species Mouse (Mus musculus) [TaxId:10090] [48416] (1 PDB entry)
  8. 6134Domain d1ap7__: 1ap7 - [19170]

Details for d1ap7__

PDB Entry: 1ap7 (more details)

PDB Description: p19-ink4d from mouse, nmr, 20 structures

SCOP Domain Sequences for d1ap7__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap7__ a.118.2.1 (-) Cell cycle inhibitor p16ink4A {Mouse (Mus musculus)}
gsmlleevcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspaval
ellkqgaspnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireg
hssvvsflapesdlhhrdasgltplelarqrgaqnlmdilqghmmipm

SCOP Domain Coordinates for d1ap7__:

Click to download the PDB-style file with coordinates for d1ap7__.
(The format of our PDB-style files is described here.)

Timeline for d1ap7__: