Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein Cell cycle inhibitor p16ink4A [48414] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [48416] (1 PDB entry) |
Domain d1ap7a_: 1ap7 A: [19170] applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1ap7 (more details)
SCOPe Domain Sequences for d1ap7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ap7a_ d.211.1.1 (A:) Cell cycle inhibitor p16ink4A {Mouse (Mus musculus) [TaxId: 10090]} gsmlleevcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspaval ellkqgaspnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireg hssvvsflapesdlhhrdasgltplelarqrgaqnlmdilqghmmipm
Timeline for d1ap7a_: