SCOPe 2.08: Domain d1ap7a_: 1ap7 A:

Lineage for d1ap7a_ (1ap7 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein Cell cycle inhibitor p16ink4A [48414] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48416] (1 PDB entry)

8. Domain d1ap7a_: 1ap7 A: [19170]
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1ap7a_

PDB Entry: 1ap7

PDB Description: p19-ink4d from mouse, nmr, 20 structures

PDB Compounds: (A:) p19-ink4d

SCOPe Domain Sequences for d1ap7a_:

Sequence; same for both SEQRES and ATOM records:

>d1ap7a_ d.211.1.1 (A:) Cell cycle inhibitor p16ink4A {Mouse (Mus musculus) [TaxId: 10090]}
gsmlleevcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspaval
ellkqgaspnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireg
hssvvsflapesdlhhrdasgltplelarqrgaqnlmdilqghmmipm

Timeline for d1ap7a_:

• d1ap7a_ first appeared (with stable ids) in SCOP 1.55, called d1ap7__
  
• d1ap7a_ appears in SCOPe 2.07