Lineage for d1ap7__ (1ap7 -)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 338069Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 338070Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 338071Family d.211.1.1: Ankyrin repeat [48404] (12 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 338082Protein Cell cycle inhibitor p16ink4A [48414] (2 species)
  7. 338088Species Mouse (Mus musculus) [TaxId:10090] [48416] (1 PDB entry)
  8. 338089Domain d1ap7__: 1ap7 - [19170]

Details for d1ap7__

PDB Entry: 1ap7 (more details)

PDB Description: p19-ink4d from mouse, nmr, 20 structures

SCOP Domain Sequences for d1ap7__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap7__ d.211.1.1 (-) Cell cycle inhibitor p16ink4A {Mouse (Mus musculus)}
gsmlleevcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspaval
ellkqgaspnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireg
hssvvsflapesdlhhrdasgltplelarqrgaqnlmdilqghmmipm

SCOP Domain Coordinates for d1ap7__:

Click to download the PDB-style file with coordinates for d1ap7__.
(The format of our PDB-style files is described here.)

Timeline for d1ap7__: