SCOP 1.55: Domain d1lrv__: 1lrv -

Lineage for d1lrv__ (1lrv -)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)

4. Superfamily a.118.1: ARM repeat [48371] (6 families)

5. Family a.118.1.5: Leucine-rich repeat variant [48396] (1 protein)
   this is a repeat family; one repeat unit is 1lrv A:123-147 found in domain

6. Protein Leucine-rich repeat variant [48397] (1 species)

7. Species Azotobacter vinelandii [TaxId:354] [48398] (1 PDB entry)

8. Domain d1lrv__: 1lrv - [19146]

Details for d1lrv__

PDB Entry: 1lrv, 2.6 Å

PDB Description: a leucine-rich repeat variant with a novel repetitive protein structural motif

SCOP Domain Sequences for d1lrv__:

Sequence; same for both SEQRES and ATOM records:

>d1lrv__ a.118.1.5 (-) Leucine-rich repeat variant {Azotobacter vinelandii}
tpigdcrvcsfrmsllltgrctpgdacvavesgrqidrffrnnphlavqyladpfwerra
iavryspvealtplirdsdevvrravayrlpreqlsalmfdedrevritvadrlpleqle
qmaadrdylvrayvvqrippgrlfrfmrdedrqvrklvakrlpeeslglmtqdpepevrr
ivasrlrgddllellhdpdwtvrlaavehaslealreldepdpevrlaiagrl

Timeline for d1lrv__:

• d1lrv__ appears in SCOP 1.57
  
• d1lrv__ appears in the current release, SCOPe 2.08, called d1lrva_