PDB entry 1lrv

View 1lrv on RCSB PDB site
Description: a leucine-rich repeat variant with a novel repetitive protein structural motif
Deposited on 1996-11-05, released 1997-03-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.204
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1lrv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lrv_ (-)
    tpigdcrvcsfrmsllltgrctpgdacvavesgrqidrffrnnphlavqyladpfwerra
    iavryspvealtplirdsdevvrravayrlpreqlsalmfdedrevritvadrlpleqle
    qmaadrdylvrayvvqrippgrlfrfmrdedrqvrklvakrlpeeslglmtqdpepevrr
    ivasrlrgddllellhdpdwtvrlaavehaslealreldepdpevrlaiagrl