Lineage for d1lrv__ (1lrv -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50498Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 50499Superfamily a.118.1: ARM repeat [48371] (9 families) (S)
  5. 50573Family a.118.1.5: Leucine-rich repeat variant [48396] (1 protein)
    this is a repeat family; one repeat unit is 1lrv A:123-147 found in domain
  6. 50574Protein Leucine-rich repeat variant [48397] (1 species)
  7. 50575Species Azotobacter vinelandii [TaxId:354] [48398] (1 PDB entry)
  8. 50576Domain d1lrv__: 1lrv - [19146]

Details for d1lrv__

PDB Entry: 1lrv (more details), 2.6 Å

PDB Description: a leucine-rich repeat variant with a novel repetitive protein structural motif

SCOP Domain Sequences for d1lrv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lrv__ a.118.1.5 (-) Leucine-rich repeat variant {Azotobacter vinelandii}
tpigdcrvcsfrmsllltgrctpgdacvavesgrqidrffrnnphlavqyladpfwerra
iavryspvealtplirdsdevvrravayrlpreqlsalmfdedrevritvadrlpleqle
qmaadrdylvrayvvqrippgrlfrfmrdedrqvrklvakrlpeeslglmtqdpepevrr
ivasrlrgddllellhdpdwtvrlaavehaslealreldepdpevrlaiagrl

SCOP Domain Coordinates for d1lrv__:

Click to download the PDB-style file with coordinates for d1lrv__.
(The format of our PDB-style files is described here.)

Timeline for d1lrv__: